PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 241aa    MW: 27227.7 Da    PI: 9.2199
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930543genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3521.3e-1658136989
                HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
         B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                ++l++  l+l  +f  ++g+++++++tl+    s +sW v   ++ k+g+y+l+kGW+ F+++n LkegD+++F  ++r++
  462930543  58 SALERE-LSLAPTFRGAIGLQEPCTITLKTSMDSTKSWLVCG-FQSKKGSYLLAKGWRLFCQENSLKEGDICTFNASSRKR 136
                555665.999999*9999***99987777777888*****99.8999999*************************776544 PP

2B349.95.9e-16148227383
                EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
         B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                ++ ++  + +s+ l+lp  f+e +g+ +++ +tl+   +s rsW+ ++   k+s++++ + GW  F+++ng+++gD+++F 
  462930543 148 TKKISTKAIESC-LYLPQAFCEGIGIREPSMITLKTSMSSTRSWQARILPYKNSSHHLWGLGWTIFCRDNGINAGDICTFN 227
                556667777887.************9988877777777888*******88999999************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010190.2233145IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-1248131IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.0E-1458135IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-1263136IPR003340B3 DNA binding domain
CDDcd100172.36E-1074129No hitNo description
PROSITE profilePS508639.55981142IPR003340B3 DNA binding domain
PROSITE profilePS5086310.715145241IPR003340B3 DNA binding domain
SMARTSM010190.0034147239IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.8E-14148230IPR015300DNA-binding pseudobarrel domain
CDDcd100172.17E-10150226No hitNo description
SuperFamilySSF1019361.18E-13150234IPR015300DNA-binding pseudobarrel domain
PfamPF023628.7E-13153228IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MCICLSDQAS TLPESGKQQE APFDCIKKHK CKNKATLQKL SYYKIGPPSW IRKQINFSAL  60
ERELSLAPTF RGAIGLQEPC TITLKTSMDS TKSWLVCGFQ SKKGSYLLAK GWRLFCQENS  120
LKEGDICTFN ASSRKRDVFE IGPPAWITKK ISTKAIESCL YLPQAFCEGI GIREPSMITL  180
KTSMSSTRSW QARILPYKNS SHHLWGLGWT IFCRDNGINA GDICTFNIVE IILWHIVITH  240
H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9S1933e-81A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012124m5e-35(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-09B3 family protein